General Information

  • ID:  hor005480
  • Uniprot ID:  P55319
  • Protein name:  Adipokinetic hormone 1
  • Gene name:  NA
  • Organism:  Locusta migratoria (Migratory locust)
  • Family:  AKH/HRTH/RPCH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Locusta (genus), Oedipodinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007629 flight behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLNFTPNWGT
  • Length:  10(23-32)
  • Propeptide:  MVQRCALVVLLVVAVAAALCSAQLNFTPNWGTGKRDAADFADPYSFLYRLIQAEARKMSGCSN
  • Signal peptide:  MVQRCALVVLLVVAVAAALCSA
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Threonine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes release of diglycerides from the fat body and stimulation of muscles to use these diglycerides as an energy source during energy-demanding processes
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P55319-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005480_AF2.pdbhor005480_ESM.pdb

Physical Information

Mass: 133799 Formula: C54H76N14O16
Absent amino acids: ACDEHIKMRSVY Common amino acids: NT
pI: 6.11 Basic residues: 0
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: -82 Boman Index: -1279
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 39
Instability Index: -3526 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  958472
  • Title:  Structure of locust adipokinetic hormone, a neurohormone that regulates lipid utilisation during flight.